Coupled Neutron-Gamma MultigrouF. Cross Sections for 29 Materials f. to Nuclear Weapons Effect Calc. Generated by LASL/TD Divi: .
|
|
- Clare Clark
- 5 years ago
- Views:
Transcription
1 c LA Coupled Neutron-Gamma MultigrouF Cross Sections for 29 Materials f to Nuclear Weapons Effect Calc Generated by LASL/TD Divi: ( (b ; 10s scientific I I r) of the University < 4 /\, -DO NOT CIRCUL = = alamos laboratory of California LOS ALAMOS, NEW MEXICO PERMANENT REQUiREDBY RETENTJ( / CONTRA UNITED STATES ATOMIC ENERGY COMMISSION CONTRACT W ENG 36
2 This report was prepared as an account of work sponsored by the United States Government Neither the United States nor the United States Atomic Energy Commissio nor any of their employees, nor any of their contractors, subcontractors, or their employees, makes any warranty, express or implied, or assumes any legal liability or responsibility for the accuracy, completeness or usefulness of any informatio apparatus, product or process disclosed, or represents that its use would not infringe privately owned rights Printed in the United States of America Available from National Technical Information Service U S Department of Commerce 5285 Port Royal Road Springfield, Virginia Price: Printed Copy $76 Microfiche $145 \- i
3 LA UC-34C ISSUED: February scientific Iamos Laboratory of the university of California LOS ALAMOS NEW MEXICO Coupled Neutron-Gamma Multigroup-Multitable Cross Sections for 29 Materials Pertinent to Nuclear Weapons Effect Calculations Generated by LASL/TD Division by H A Sandmeier G E Hansen R E Seamen T J Hirons A H Marshall A \
4 COUPLED NSUTRON-GANNA MULTIGROUP-MULTITABLE CROSS SECTIONS FOR 29 MATERIALS PERTINENT TO NUCLEAR WEAPONS EFFECT CALCULATIONS GENERATED BY LASL/TD DIVISION by H A Sandmeier, G E Hanse R E Seame T J Hirons, and A H Marshall ABSTRACT * -J This report lists 42-group, coupled, neutron-ganmnacross sections for H, D, T, 3He, 4He, 6Li, 7Li Be 10B, llb, C, N, O Na, Mg, Al, Si, Cl, A, K, Ca, Fe, CU W, Pb, 23ju, ~38u, 239pua and 24aPU Most of these materials are used in nuclear weapons effects calculations,where the elements for air, ground, and sea water are needed Further, we list C}OSS sections for materials used in nuclear weapons vulnerability calculations, such as the elements ofhigh explosives as well as materials that will undergo fusion and fissio Most of the common reactor materials are also listed, The 42 coupled neutron-gamma groups sre split into 30 neutron groups (17 MeV through 139 x 10-4 ev) and 12 gamma groups (10 MeV through 01 MeV) Data sources and averaging schemes used for the development of these multigroup parameters are give I INTRODUCTIOIT Coupled neutron gamma cross sections are being widely used among vulnerability and weapons effect investigators in the US k!ehave reported their use in several Los Alamos Scientific Laboratory (1ASL)reports dealing with nuclear weapons neutron 1 and gamma output and nuclear weapons effect studies 2 in the atmosphere The advantage here is that the combined problem of neutron-transport,neutron induced gamna productio and gamma transport ia done in one calculation with coupled neutron gamma cross-sectionsets Unfortunately, up until very recently, the neutron and gamma production cross sections have been prepared separately It was * therefore not surprising that we had to match up m the neutron and gamma production data accordingly This was especially true in the thermal energy range II FORMAT FOR COUPLED NEUTRON-GANNA CROSS SECTION SETS The general format of a coupled neutron-gannna cross-section set is shown in Table I The first column lists the discrete ordinate S format for n cross sections used at LASL, ie, u a f ~g ~gg u g-l%> g_2+gs s Ug_41% The table length in the vertical direction is 45 The 30 neutron and 12 gamma group numbers are labeled along the top The cross section sets in thla report do not contain any photoneutron productio and an energy upscatter mechanism for neutrons or gammas is not allowed for The neutron-energy group structure (1 through 30) is listed in Table 11 and the gamma-energy group structure is listed in Table III The multigroupmultitable cross-section sets for the 29 materials are listed in the Appendix A LASL code NGXSEC was written by one of us (Al+i)to assemble the three components for the coupled sets, namely, neutro gamma, and gamma-production cross sections 1
5 I TABLE I FORMAT FOR 42-GRoUP (30 NEUTRON AND 12 GANNA) COUPLED NZUTRON-GAMMA CROSS SECTION SETS IxSEC! NEUTRON GROUPS I GAMMA GROUPS I ccl Vuf 9 I , 2; ! / /39/40/ _w ~31-?l - Cl- I -9 rl- 3Q--!pl-32 II-2-Q !-33 %-3-g i GAMMA-TRANSPORT CROSS SECTIONS 1$-5-9 f ~-+g b J~ 31- % -7-g ~-&g -9 -g -lo-g -1 l-q g -[4-g --ls-g ~-16-g NEUTRON-TRANSPO RT CROSS,SECTIONS =&17-g E$ w4q 3{ ! ?j_-18-g _?j GAMtJA-PRODUCTION CROSS SECTIONS %-20-6 %-21-g : -22-y?J -23-g %-24-g u g-25-g u g-26-g 0 ḡ-27-g : -28-g %-29-( IJ ml o I-32 c g-32-g o 0,-33?j-33-g o 0 0 I-34?J-34-IJ o I-35 %-35-g ,-36 &36-g o I-37 % -37-g o I-38 %38-g c1 c1 n n n n n n t g _, I -40-q -41- I i m Tooo,-in 2
6 1 ABLE11 ENERGY BOUNDARIES, AVERAGE ENERGY, AND ENERGY ANU LETHARGY WIDTHS AND VELOCITY FOR THE LASL/TD 30-GROUP NEUTRON STRUCTURE E 17 MeV, 1 ~/s = 1 cm/sh; 1 Shake (sh) = 1o-8 sec max Group Eg (Low Boundary) Eg AE Aug Vg (Mmls) MeV MeV MeV MeV MeV 1573 MeV 1407 MeV 1289 MeV 1101 MeV 8705 MeV MeV MeV MeV MeV MeV , MeV MeV 6789 MeV 4508 MeV MeV MeV , MeV 3219 MeV 815 MeV MeV 2510 MeV 633 MeV MeV MeV 1962 MeV 1527 MeV MeV MeV MeV 1055 MeV 530 MeV MeV MeV MeV 6487 MeV 3962 MeV 2363 MeV MeV MeV MeV MeV MeV MeV MeV MeV ev ev ev ev ev 1115 MeV 0410 MeV 0150 MeV 55 MeV 2034 kev 7489 kev 2753 kev 1013 kev 0373 kev 0137 kev 1164 MeV 0428 MeV MeV 577 MeV 2115 MeV 7810 ev 2870 ev 1056 ev 388 ev 1428 ev ev ev 50 kev 186 ev 526 ev 193 ev ev 6839 ev 716 ev ev ev 2509 ev 0359 ev 262 ev ev
7 I I Group 1 (31) 2 (32) 3 (33) 4 (34) 5 (35) 6 (36) 7 (37) 8 (38) 9 (39) 10 (40) 11 (41) 12 (42) III TABLE III ENERGY BOUNDARIES FOR THE LASL/TD BASIC DATA 12-GROUP GAMMA STRUCTURE E = 10 MeV msx Eg (Low Boundary) (MeV) , Eg J!a!l (:V) A Basic Neutron Cross-Section nata References No J Isotope l-h-l l-h-2 1-H-3 2-He-3 2-He-4 3-Li-6 3-Li-7 4-Be 5-B-1O 5-B-11 6-c 7-N Source of Data Evaluation based on work of L Stewart et al, LA-4574 (1971) Evaluation based on work of A Horsley and L Stewart, LA-3271 (1968, updated 1970) Evaluation based on work of L Stewart, LA-3270 (1965, updated 1970) Evaluation based on work of L Stewart (documentationnot available)! Evaluation based on work of L Stewart (documentationnot available) Evaluation based on AWRE data (1965) Evaluation based on AWRE data (1965) Evaluation based on work of R F Hunter, VP-3, VP-1 and VP-123 ( ) Evaluation based on data from LLL Howerton Library (1966) Evaluation based on data from LLL Howerton Library (1966) Evaluation based on KAPL-UK data (1965) Evaluation based on work of P G Young and D G Foster, LASL, ENDF/B-11, VAT = 506 (1971) N Isotope 8-O 11-Na 12-Mg 12-A1 14-si 17-CI 18-A 19-K 20-Ca 26-Fe 29-Cu 74-W 82-Pb 92-U u-238 Source of Data Evaluation based on work of P G Young and D G Foster, LASL, ENDF/B-111,MAT = 1134 (1971) Evaluation based on ANRE data (1965) Evaluation based on data from LLL Howerton Library (1965) Evaluation based on old LASL/3 D-4 set (1966), and work of R E Hunter, VP-103 (1970) Evaluation based on work of M Drake, GGA, ENDF/B-11, MAT 530 (1968) Evaluation based on data from LLL Howerton Library (1965) Evaluation based on old LASL/TD-4 set (1966), and work of R E Hunter, VP-73 (1969), Evaluation based on data from LLL Howerton Library (1965) Evaluation based on AWRE data (1965) Evaluation based on old LASL/TD-4 set (1966), and work of R E Hunter, VP-103 (197~) Evaluation based on UK data (1969) Evaluation based on work of R E Eunter, vp-63 (1969) Evaluation based on AWRE data (1965) Evaluation based on work of J J Berlijn et al, LA-3527 and VP-63 (1968) Evaluation based on work of J J Berlijn et al, LA-3527 and VP-63 (1968) 94-Pu-239 Evaluation based on work of R E Hunter et al, LA-3528 and VP-63 (1968) 94-Pu-240 Evaluation based on work of R l? I!unter et al, IA-3528 and VP-63 (1968) B Basic Neutron-InducedGamma-Production Cross- Section Data References JNo Isotope 1 l-h-l 2 l-h-2 3 l-h He He Li Li Be Source of Data ENDF/B-111, MAT 1148 Thermal valuea adjuated by HAS/GEH No gamma production in current act No gamma production in current act No gamma production in current set No gamma production in current set Old LASL/TD-4 evaluatio Old LASL/TD-4 evaluatio u -h; g = 19-3 h = 38, adjuate!by HAS/GEH ENDF/B-111, NAT 1154, proc by Laphan u30-h; h = 31-42, adjuated by HAS/GEH
8 No J Isotope 5-B-1O 5-B-11 6-c 7-N 8-N 11-Na 12-Mg 13-A1 14-si I?-cl 18-A 19-K 20-Ca 26-Fe 29-CU 74-W 82-Pb 92-U U-238 Source of Data Young-Seamen described in memo 6/8/73 No gamma production In current set Neutron cross sections taken from KAPL-UK evaluation (1965); gamma-ray spectra and multiplicities based on LASL/TD-4 memo of Stewart and Hirons (11/10/71) ENDF/B-111, MAT 1133, proc by LAPHAN- 630-h, h = adjusted by HAS/GEIi ENDF/B-111, MAT 1134, proc by LAPHAN ENDF/B-11, NAT 51, ~3&h, h = 31-4L adjusted by NAS/GEH ENDF/B-11, MAT 52 ENDF/B-111, MAT 1135, proc by LAPHAN- u30_h, h = 31-42, adjusted by HAS/GEH ENDF/B-11, MAT 53 U30 h, h = 31-42, adjusted by HAS/GEH ENDF/B-11, MAT 54, ~30_h, h = adjusted by HAS/GEH Nade up by HAS/GEH ENDF/B-11, MAT 55, u3&h, h = 31-42, adjusted by HAS/GEH ENDF/B-11, MAT 54 u3&h, h = 31-42, adjusted by HAS/GEH ENDF/B-11, MAT 118 u3&h, h = 31-42, adjusted by HAS/GEH Based on GRT work for neutron energies >5 MeV; at lower energies, the (y) cross section from a UK evaluation was used in conjunction with the thermal capture spectrum reported Ln ORNL-4382 Young (5/73) DNA MAT = 128, 129, , 6g_h; g = 24-3 h = 31-42, adjusted by HAS/GEH ENDF/B-111, MAT 1136, proc by LAPHAN- u30_h, h = 31-42, adjusted by HAS/GEH ENDF/B Format (Stewart and Hunter) V-III N, ~g_h; g = 23-3 h = 31-42, adjusted by HAS/GEH ENDF/B Format (Stewart and Hunter) V-III N, Ug-h; g = 20-3 h = 31-42, adjusted by HAS/GEH 94-Pu-239 Based on work of Hunter and Stewart, LA-4901; available In ENDF/B format using neutron cross sections from LA-3528; local LASL MAT # = 304 ug-h; g = 22-3 h = 31-42, adjusted by HAS/GEH 94-Pu-240 Based on work of Hunter and Stewart, LA-4901; available in ENDF/B format using neutron cross sections from LA-3528: local LASL MAT //= 305 u +; g = 24-3 h = 31-42, adjusted b; HAS/GEH c Basic Gamma Cross-Section Data All gamma transport cross sections were processed using Sandia Laboratories GAMLEG 69 (Refs 4, 5), a version with additional features of LASL S GAMLEG code, written by K D Lathrop An option in GAMLEG 69 is used to account for the annihilation radiation that results when positrons created during pair-production eventa are destroyed The creation of two annihilation gammas with an energy of 511 MeV contributes to the gamma group-to group transfer cross sections and is calculated in GAMLEG 69 The pair-productionmechanism and hence the generation of annihilation radiation occurs, of course, only when primary gammas having energies greater than the pair-production threshold energy of MeV are present If we use a coupled neutron-gamma cross-section set in a discrete ordinate S calculatio we must n set the second entry calculated by GAMLEG 69 equal to zero for all gamma groups GAMLEG 69 inserts here u f!l,g the fluorescence cross section plus Zxu ie, two times the pair-production cross PP913,sectio If erroneously these entries are left in an S n calculatio we would create neutrons from the above interactions since the second entry in the gamma groups would be treated no differently entries in the 30 neutron groups, ban he Uf;g which will distribute fission neutrona according to the 30 Xg fission spectrum numbers ACKNOWLEDGMENTS We would like to thank Doris Dunning for the tedious job of assembling the coupled cross-section sets with the Neutron Gamma Cross _ Section code NGXSEC She also made some modifications in the code ao that the data from GAMLEG69 can be read into NGXSEC properly R J LaBauve has been helpful in the adjusting of neutron and gamma production cross sections REFERENCES 1 H A Sandmeier, S A Dupree, and G E Hanse ElectromagneticPulse and Time-Dependent Escape of Neutrons and Gamma Rays from a Nuclear Explosio Nucl Sci Eng Q, (1972) 2 J E Campbell and H A Sandmeier, Airtransport Calculations Using the LASL-NWEF Air Flux Tape and the NWEF Computer Program--CDR, US Naval Weapons Evaluation Facility (NVEF) report 1090 (1972) 5
9 3 Valdoata Physics Reports, LASL interual docu- Problems by the Method of Discrete Ordinates, ments written by Dr R E Hunter at Valdoata Sandia Laboratories report SC-RR (1969) State College, Valdosta, Georgia, while under consultant contract to LASL 5 S A Dupree and H A Sandmeier, Photon Tranaport Calculations Using the Method of Discrete 4 J H Renken and K A Adama, An Improved Ordinates, Vol II: User s Manual for GAMLEGX Capability for Solution of Photon Transport and T)TPXRAY U S Naval Weapona Evaluation Facility (NVEF) report 1035 (May-July 1969) 6
10 APPENDIX HYDROGEN (Hi) Neutron ID = 8, Atomic N = 1, Table 1 OnouP 2 13ROUP J OROUV b Ollow 5 OROUP 6 OIEouP E M E-IM 3075 E6E0* nọ sqsq&?r o 6 S6991 E2 ~ ~, 9,7097 V2E,v57950k Oz 7185 n2tol 5?801VE O1 32 W 51C0* u117b7e oo 1 W5SJE JE, /6221?E ol?733uue01,381 Z?3C Z721E E VC,lZb79UE,1 OIO06E OO WV71OC-OL,314087F-04,121460E S5E-01,20831 F, C v9&506e-r31,s3921nc-01,676 SOQF01 *05906C b1eb EIE E 29?7nl E*oo lnn8174r oo 139 E?) E t f 9*8241 C01 OROUP 8 OROIIP 9 OROuP 10 ORouP 11 OI?OUP 12 ORO P ]3 OROUP 14,355093E-04 Y04266C01 7+3r770c-al 3 Z3525E4,157? 3?E,1 bfl~e*oo b4q93ve-nl 596E b2b?e f ol ~ ~ * S, OllOuP E-04,? Y1488L **, 137nQln Lnl 4311 bot *,?525bllk,1227?6k oo,7as351tol f-01 3?5wlt E-nl, E-111 El OnOUP 16,35 b309c E?01 L06+*13E,50258 ZE,33 RO01E, LE30 9 blozbt ol 6150!5L-01 3q755n L *et-01 t6912bt ol Zooqauc ol OROuP 1?,3150 +IE,01,123011E E 3 331*3E ;2bb3wf 15 b63 i E J7/,3E, Lid E-01, C-01 1 V5011JE C13C-01 OROUP J3ZC-0* ;377459f*ol,66?5E*,11(+ 155L*OI noob*vkboo ;s Ji!ltt oo,3 f,508 3t,213!15*Eo O0 10>712t b**ne OE-01,&2vq JIE ol 31vn ElnEo&,71 Ei0v2t oa 2i!Jt3QE-Oi OROuP EOb RF01,6 b1469e izf1641f ol F 489 b16e L,22319 ~E,13057?F F-01 * Obll$E ol 2637 b3f-01,195525f b17f oi,13$02?e-01 mow 20,380514E-Ob a i629630e01, RE OO Z01 79?571 L *7E*O0 29 W31E,2010 6E,13 A397E 7v75b5F-01 3n7b51r-ol 26a27!nE-01,16101?E-01 lkq61~e-01,1 OI37OE-OI E?1050 E-o2 OROUP 21 Slszblc ob,n14t66e n] 1,12037 EIT1 213,5 ue01,io015?e01, 7245( [~o?67?73f qe130,17z7pi E (126 Pb3E,1, P>316E 1 23+>?1[-?1!5nt62k-ol q1575f-,2 72SPR c-,32,h15172e- Z W1772[-13Z Io+163E-03,2092 U8E RIE * E*02 3 n24?c ol : L01,b51s5blIC nl, t01,208 b77c*pl,1658 blk K0~ 7h Rolut k L* U2k*O GVL 1771 HQt oll,v62q31e-01 12? HC CIII b51qr!b L-nl,llo7535t ol 66?3(, IIL t -ol 2971,? 1L-01,229468t-nl, L-01 Osb+dllncr!z 71 02?k E-7 1?370?L-01 8 b3r%e02,540n33e-oz,35! OI*L-O C SL MIL-02,3&160blEE03,1726 MbE oz 5 b3q, E,31 E15617YE01 1d52?E ol,b079ltf 2 LI14Y+C 1330 >ZC : E-01 J57L3>JE,31,z31?81101 lb205dc ol leir,9, (E ol b3b3b>e02 Joqlb,c-~2 lv8131e ~,? 12 R6LI,1 E,2 +5b >OE03 :IJl 5 oe rz3,6562 LI,E E1207E O EOZ 5n40 i3c01,7 bt1331e OA 2 b1b66k 01,6 HJ690L?2473Hf,10)513 bt,*ll ~#51L-13,?32$50[-01 l?al3l-ol 127* 02 bt-od,5 V 3Z5L-13*,45 %tie-od,23* I 7ZE-OZ,ll>!hmk-od??qll>t-o> 47>2JVE qt tt-oj,? 314,? IJ1L,241502E-03 llq60se-02,187s97e *02,5q80Q7E01? M0170~E < 01, qc,2*9q771f oll 820), hf-01 :37 WIC01,179487F-01, F02,4159 RE-02,32220 Vf-02,218504[-02,]*t, n7gf132,n5f13$,3e RC %RF ,67F03,12901?E F-O f [-OZ 18q\a +c C01, E01, E ~7E01,326 R36E, +2??1PE-01,30? f153e-01 lb Ll?07C b@e-02 3!5318[-02, ? O2 t10715&e-03,51217 he 03,316 Q6<C ~1E-03 9*+ IRQ3C-! S<57-04,b767qil C-06,60373,1 E SL36E-0+ 8n0b* 23 wow a+ Rou, ~, wow ab OE-O2,] F197 %F 2,,, ll, r,, l,,,1,),,/,,, V,, U!/,,,,Iornt,a,ol, I, 7 1 I,I?!ll1,70,,Vnllf,, 1117,4 :1! 51%> 11 f-n2,$!s~f-? l)~, r l?f -?,5 UI OF,, 3722,C,73 -$660VC,33 :; WY, E- 3 ] 16*7 be Q3 5 b5c7!f-, 36z651E04?35307E , E,,,183 A3E E S6n Kn2,Iv,lftlkoa,M,19,, %11 ) 111,,,,11,,,1 2,8, > 11,,,,In?,ohl,, l,,~,1!4,,, * 1 11,l,,l,,, 4,,,,,,,, 12 ha, t-ol,+,),,/1)? 11$ ,? H9hl 471-,1,+,~h?,l -, >?lrbhco~ ~16rn P7k-(13 I13VI*IL-,S t -04 4?5v k-r z~nzzpk,133* 45k-n4 n66167t k05 5 Q5q24L-rIs b476ti ~Oa t9n74+~ a,, nlliv,,, 1, 1,,,,,,,,,,,,Il,lrl, 1,ol,,,, o11,1+78)1,,1,,,!,,,-, Ica?, llt-nl,8!,,,, 15n63ft $vf, vc!l> J, >!t,13 lbl hut-u3 H?3n7, t,591 n? Jt06 40 i66t ob Z+9,113L- 157,9L Q33t-05 *913,?30t urt b7f05? O0553E : 1,,,,,,,1638~c~1 i47vvr oa,(, 1! I#t,, 1!,,,,,,,,, 1 l v,l, 1 I!ll?lnl i +!7,,,l) 0 14! 1 ) 0,,,!,,,,,111,s,l r i 5 VI V<, (1, <*61 YF,33 l?iiii?l03 % I5V<E-134,3z1610t,3a 4175 Q[-@ 14?611E EIb W15ZJE-(!$ 37 V6>JE-,Z5? U1613E H3E *6,35 Z3?960L01 1 V0410C O4,1, v, vv,,,,!,l,,,,!,,,,,,,1,4,,,11(, hllhl ant,,1/,, 0,1,,4 *V, s4 /,-, Iwlr,rz,,,, ]lf /?,, t,i,,lt-nd,a/l, ht-n J,71110 /Ot-OJ V )vdt- 44e, r3f 0*,2)?3hllf-OC llli31 it-0* R013JME03 5* J6J2E-03,36>lb0E-o Y zl J415t Ol! lo J71s Eoa 3916~-Ob hnh, tl, ~,,11,,,!!?, 1,, vv, f$,, 1104!ll 01,,nt, l;, F,,3 l*,la,l rrln,!,,,,,1,1 VV,,03-, - l tlv80(, # -0> 2$!(I 12<I 02 t, n7q,ak - I 2#,,!l)lf-l J3 7 Hbo5t -04,3!6 0[ RI F ?E ? +f F05 293w6F-o S,19042 he f05 t lnnef, rna,611,, 7,? 01 1,,(,,,,,, 1,,,,,,,, )!l!/8111 nl l,ol ),,,, ~f111nn!,,,!!,!,, -,,/,,l,,, }- 1 I r,a, -o> 7t fo31r -*>,,,,,,,,,,,/ 4,1 A3,, o3 Hh5V17E , LC-O,128530f-ob 6075 VPE05 2 R139z6E E t05
11 n170up?9 OUOUP 3!7 allow 31 OROUP 32 OnOuP 33 onoup 34 OnOuP OE*OO Z9EU VbE-02 Z41319E OE c 191? 59 E02 11s979t@ f-01,601512E hc-ol b1037af, 1,?13r,7qt t oz,1698 oe-oz Z17101E O2 P1677HC*01 3n01t7c01 lzqisfik b73l455t* l flz,zu3415e-02 ] 106![ wt111 *072?LE 6 b] W16t,OIZ lb9n92e*oo 5513?tE-nl 236? *13t oo R6Q+7nt-fil? flzllw 7*lq13F 27197, ol -52 E-02,Ilwlnk qt 4315 nl E-O2 (1 Q17147E113,156917t-n2!3, 339e2, f ht03 0-, F-f13,lQ39h5t!l,,309534E E-06 1 O159VE O *5E-06 a75fc ~ E-n5 r *, P,?22319E-o S II K-05 Onou? 37 ) C t-04,Z65677E-Ob, [-04 35*3 *%E-od zl173llue-o K 2 T98V3C-0* Ouou? >a mow 39 OIMIUP O E E-01 zn7zb5e02,455? ZM02,360719C f E-04 OROUP zc-oz 79 boloeol 397n5LE X-02 &6 b75b E ) 4&E Eo2 30 Z8f ?nE-ot E-05 anoup * b9e Flz b6e-01 5n7151 E-02 a5180n E-132 ~ Q? * * r P * P E O7E*OO,Q5368Qf t-*1 Rqh93b~-n2 6s9694E-oz,561875L-o? 4755 V7C OZ a1345bt*2 7 7q44b6E-n5 J499bOk-n4,303629C L-05,363033E-03,12 Q5b?t* 1613 **L E3L01,139qhnt-ol 113*hu Jr- o V9k OZ 7!3705t-Oz 6121 but-oz L-02?5R2L 101 OIVL OO b+pqtlot-ol 393! Hit-01 Z38R4>L-01 l* Mbolol l17117n\k-ot k-i72 3?76\5t -oz Mt-oz 11719bW OZ,697973k ?87?[03?04059L03 :lollwlbl Z?5t-06 42n450t mbt ob,30nh10f ob t-04 z02zl-ob 6191 e8e04,17391 ze +7+o I?E-01,43t134 E-ol 2620 ZZE-01 IV2!JV5E01,153 WK R9b1E-01,111+ 8BE-01,903 L114E-02 0u151W-02,4 bb799e-og,z446z1e 7113rz13FlE-ol,h27b J7E-ol ql-01 z3 +2+ck-ol,7207t H462E-01 17,551 *E-01 ISJlb83E-01 li?993e-01,15031 *E-01 u E-06 3h4903F,3376 M7f,1559 E b3829q E-01,35997 hf ol?5z6n6e QPE01 158& 77t ?fE ol ZK C O b4e02 El 206* 54E-03, E*OO 5575 *5E,27 Z214E-01 Neutron ID = 8, Atomic N = 1, Table 2 OQOU* 1 IVIOUP 2 OROUP 3 OROuP 4 OROUP 6 OROUP 7 Il *, b08240t-o Z Z972E-02 S4W50C-01, K-o Z 6 U43Elt-01 5 Z1013E-OI,290308E-01 15** 5H3- I05392E*O E01 6&70 zeeol E ol E, E OO c $E E Q4)E, E E 1257 =,6E a57785e ol,69z637e b03e01 8
12 Onolw o OROUP v OROUP 10 OROW 11 (lnoup 12 OROUP 13 OIEOIJP lb 7, r 77 f75111eol f K,755 b54ti L-,,24, LllqL nl K,,13511J6t 7!) 1253< 1 ($, ( f,0e M731E f0o bc oo 5?74?3501,29513 nt01 16 Q, VVC Ll, 1157?4L01 Val?nbt-oz 71 b5h0k JIE oo 5163 b<e 3097 /U E IL13Qbb E u21b*3e ol 3 bn30vf-ol z037?e ~l Ilb?>c-ol UO?71C, L02 hbh539[ oz 4 Vb3UOf OZ E 9 VV371E 5 +7b?15E 3% H5Z6t,71/81 Zt,Iobbllt oo lhol +l+t ol 23 X93L bbt-ol,??14?$e-13z,7b/rjbot-o;,5n022mt-ot,s59065e, I04267C01 &768 R Foo? U5107f,171 O F,3O 1015?2C OO,50H77r-~*,19917 Afi31 11?376C-01,b*%191~_Ll Z r-02,3571 h7t-oz,270203f-02 OROIJP 13 OROUP 16 onnw 17 mow JP19 OROUP 20 7s413RE E [ 727? 30 C 135n7nc oo 8167i51!r ol 4n>nh Tr01,26?4E11L01 V5Q9!IC-OZ, E,32 31 J6t ~k-o2 227w9r ?I, L-o Z 1 Z5761E-02 OROUP 21 II, 39f!h3E 16 Q732E01 L?7601E 73*15 w LILl 107 IO EOO,6+~379f-L31 3q4~&# E-01?z7 c-ol l17175c-ql 5517 )[ 2 755* 7PE-?2 l?2566f ?E-03 l, J1854L ?[-03 fi * * Q a?87618e 1,3925 >Ut LI I 3&3911 k01 ll R17t01 r60378t Oo b38907e Llll 2657 h5t 163 M78L 0 :97 R9 Ht-01,74q57?t-01 36h62b L-01 ;WWR, L,31 206ql!>f q5k m 16 V2L OI c,u5clbde-,3z,27n2 *t-rl 1513P44k-tIl 76?362t-?z E-o? L-P7 99??3t b? V9t n3 h7391flt-03 5,3< EI,, E,33 P v31475k OZ 5107! 571LO be-02 18t12JOL-02 Li P5550t-03,561 rlr5t 03,36a10Jt-03 z70735t Q41JL Zt -03 fi 0@13fJP22 OR(WP 23 OnOuP 24 Jbhldlf oz 7 b7ub1e-02,ibnl vc oz 11? bb?, E-03,3?07btf03,405553E *1 E-03,V 41FI,!E0* 8 bobbt E-o+, E-04 c ORouP 2s * Q29b1f ol,5061 b*k E,1706 P7E OU 3 v7 t-01,11? 4214[ f112q7t0< ut oz,1 J 7J3t-oz Q1Z113E OJ,61117 b? L-03 ljl,3e-oj,? b2vr t03 ll M,lJ+t LIJ, 7\*402t -0*,aqol{llt-ob 3 b9hbl- 10v2?VE-Ob 25035!t0+ 13r70uP Zb 504 P3?E C01 112i6r01 Zzobllhc oo F01, E-O? 393QQ7C-,3Z,106? 66 -oz 8 f16061f-03 bqh~-lj, 33*317 F113?261-03, t03 8 4,4E *3?62I! -O*?77~t,l r-04 1r9975f ob 1317 MF-ob C Ob, F05 OROUP,??,51)666 E01,S4>054E01!190b3F E 6566RIC v3r-02, E-rz Z l5+o17ff12 6 R773tE-03 3?719 r03,1873 bet-03!23b W-03,I131?77E-04 5h75hnf-,3 3? H?7 -O4, F-o4 11J23!IJL-04,6t,4b O?E-05 6~40? E fi675e05 33 RR63E os OROUP 28 51?31V3E 1 55 f107e ,, [01 7 b5472e 517:5 -!C-111 t24h31e F511CI2 1155E-? i534n ini?5?77 C03 173? 16E-03 67~! f 53* R!,C 4, Q77h$f b?6729c * )? LIP,,bf 177, n?e-n E05 7*615 (,E-o S 1815,7E-05,15383 ae-n E-115 Q, Y13961E1 5 b76t15t ol t nl?7r=151t*ofl 5 r,21~k -*1 la Z17Pk- 1 65n5r7k n2 l?q htt-n? 2 92, t,13 l$671yt- 3 9>~847t-, 642 g,k *4,?&$5 41L 166 V317t-n4 ] 13i qe-l 7 bh8t 5,b4*6~q L-n L-IIS,130+ J9L ? 19 C01 56rL390t ol 1271 R3t01,Z71J16L 55%75k-01,15n191t-ol 5?2711t -0Z,16 R*91L-02,,756112* 03,15h12bk-03 7??7v*t0b Iklbh k- 16?53vt-04 v*5 vlt -05,b13?ae L-c!5 61 b032t-05?79+4ql bt E01 S onlui ol,1 Z2S- EO1,273 U* L 55 VI J60 E-01 l>3312f ol 5>?h3>t 02 :) V71 XOZ,b211h E-03 i75urlk03 57 I!lOE O4 2 bflo1mt !, VII, O E E05 2 Z57110E be E-05,1028 LI1E-oS,514347E*01,s4+1s ME* *t*01 27 b181c 51,2, 11L-01 15*~h3t lzlt ot,?o Jsb +L, oz 70/ Q67t -03 zz *1 k-o> h*&rhht oe?1163bk- Q7VH6Vt03,,,llJ7t-,?7133h3t-03,IZZ82LIL-03,511 RQIE F01 12?*!hF f29e ?E-01,Isr,c,,r-ol,567173F-02 Z07Z13 F-OZ,7a fall K f, F-03,83 RI Ilc ob 23h615F Ob,77$60 Rf t C-05, *E ?oQE03,277111?E-03,963 nf r34 310q76t -04,L177P13Af c15 213R1!I E LIIE-05 olfoijp 29 OROUP 30 OROUP 31 0i20UV 32 Cltluuv 33 OROIJP 3, 13ROUP3s Slse?w o! 54 R112E pi! Z2717hFol?7373 r o 56334!!t ~1 15<s,[ -1,,77 tlr j,?owb![ 2?h??rl - 3 t71; 1711-n] 10! 33,,1!33 a$>*?slf,,lt377,w04 3? ?VE 5 Il E 2,706 53k,,ls72b6t111,w2143t, L-r, l,qn7744 k-07 l]lmr7t n2,1?17ts:l- ~ 44671, \}-, lt?3tk-r3,\m67 f,k+,,201z75t- b t 5,164576LP5 136z36c-oz L E02,2016 *2E02 il n: 4,? IF!Q56E ql Ll<,2632 b3t-ot o; * E oi!e-o2, i395665e02,5993sie02 6=5174 E b71/ c-o F 303 Sf,2C02 ~ fr 9
13 P oroup 36 mow 37 OROUP W OROUP 39 OROUP 40 OROUP 41 OROUP 42 * 50 Z560C L7* PE oz E- z,47383x? 3 R8307E E-oz ~,,94 026<-,32,123a 55 C-ol a48739e-n2 6 b246ll E-n2 S17365L-F2 43& F131C E bs63e t ol at S+ZOE be02 b0774 +t < -02 *5740 *t oz 43 R6b8E-01,372701JE VE-01,1439 V7E01 ll17b7e Jwz oz ~nltlstoz *$E02 604bbt C-OZ 75 V562E-01,61 boboe01 1 S0363E-01,Q? 3*55E-OZ 66 b3b0t-oz, t-02,42 b9v3e-ot,36165 be S38E-OZ,276645E C01,41 S051EOZ 16593W E E02 77 S534C02,64854?E02 -,55691 of o E-OZ -*33 n8~f-oz E-02 i 3 C2468E E02 Neutron ID = 8, Atomic N = 1, Table 3 Onou? 1 OROUP 2 OROUP 3 OROUP 4 OROUP S OROUP 6 OROUP 7 Il 31 Z840C E E-O boc ?C S86LIE01 o; 1360 b8e f ol SE E01, E * 07E*O0,]67475E, i?69183e*o0 0*8765E E ?E01 1 O?4O7E*OO ~Z70d5E S7E M nn7f ol, f-ol,2015?6[ E oe-o1 i%4?2w e-02 WOUP v enoup 10 OROUP 11 OROUP 13, OROUP 33 OROUP c-01 z0471qe*o0 36 b749t ? 37E-02-3 Z709RE-02,56 S703E E E-02 ~ e e Y07z20E Z057E*O h2e E-nz -63n W?7k Q511E-n2?56672C L-02 ~: b53236l OLIIOC-O JRL 14?177C*O WJZ OZ - V417V7E E-O?, E-02 -, t-oz c2e-02,8217 S0f b5e*oo 1705 f?oc oo,b04168e01,5%?151e-l72 -l15bt12e-01 -l IoQov E-01 - W290VE JE-02,653 $E E-02,zQ5555E*O U7L*O E*O0,8 SE I105E:O1 *a3951t-oz -,? E1707E-01 -?65356c-01-20!328W Zk-01,11 V047L Z2E-OI -,057019E-OZ,4a77no Eoo C 11355nc oo 5134E72E-oZ E-01, blnb?7e ol -35 Z&01 E F at ol,107565f O1 S2670ZE02 70 V972E C02 5 b9538e*o0 T79S04E 75 M2&C C-01 - S646 65E-01 - S20776E-01 -? Z*07E-01 -m691a E-ol aoe IE-O1-71z5R5E E-02-4 S80ME E-02 OROUP 1s onoup 16 OROUP 1? OROUP la oroup 19 ORO13P20 OROUP 21,649673C*O b7e oo [ E01-6a 71217E nl -,=62261 E 1,63154 *E,71 -,317115E-01? OOll~E E-o I -,679863E oz E-02 -, E,q2-2 Q5b26t,2-073e191E02 ~ :, S, E*o I -53c031 E ZlbE*n0-1 C6743E 110-7n479t-ol -071? 521 C ?t n4k rl -a15475t01 -lf1179 wt oi k-o? 6584 S7E 2 3*n971Lllz ->nn Qbqt-o> -,23396 St-02,Z68754C E* Z* -, Z430i!3E *ME -74? 461 C-01 -,637310K b4l-01 -,2102 S4L-O1-14? 6111k01 -, C-OZ -,a05?69k e-oz -,16? 57* L S37*k M-O2 ;0602@4E we wie ,?e 235?< b O wje* - blo~l YE-01 -,3023 H2E E01 -llb711e YoE02,52271 ue-02-30s5vo E02-1 b8bbk E-02 -,9514 H* fl73 b175rn E-03-4 S9315E113 -;3092eoE E-03,336!178E D1, E*o I ZE -?7JR2?E*OU ~W,6 V,170C E ?3527F-O2 ot22117t oz -o?8b3b2l-04 olq23\2t04 -, ?E-Of,$41 J32QE OJ E WE OJ E-03 -lb3243e-o# ; E-03,345159E bhe no&e E E ?E01 -la?33!f!31, E r-02 -,2285 S5F02,]5672*F F-OZ E-03, F RE E03 -, E S49E E-04-4 Z511~E C*OI zeo01 -, E*O E E*O vae *33 E E ?M)E C02 -n63976e e-03 -, E E E r15e ?e-04 ~307607E ne M17f-04 -l S69E12E-Ob 10
14 OROIJP?2 OROUP 23 OROUP m OROUP 25 OROUP 26 OROUP 27 onow 2a flejl,166408e %6E -,631795C E, C-31 16? n?pf,1-5 Jb433E E oz -,11 M5W- I2,55(,4 Z7E 3-31n13w-03 -,70~%5QE03 - Ib2435E-03 - Q567bq F-l4 0 S5Q33) E C E-04 -l13n37f04 - R4069HE-QS COS -,576865E 5? E01 16 S042E01-72 f1337t COO 1 C3435K PO E01-212?12f-nl s991 Il!tc? 1966 *1 L, -91n3b3c-03 -O*30334L F3,?067+!34, -,l1412nk k-pb C-O* t,& 705 a14e-p L19C05-6 b0823e05 -*15938 E [-05-2t2168C-PS -2i2i?66t E O c bw -+&3657 E*oo -14! T bv4rv7e oi -2+lh6zc-ol -;779720E oz L-OZ -,72? 511ML-03, L03-15nll>t o3-75?2l ?3bk f115e-04 - IV75JME04 -,129330C-0+,756081, L ?9t05 -?35616k-o S -15? aolk05 -,l136b3e-05 3 S094Vf JHE uhe -64 S1C4E voe /ve ol -, E-01 -u69411e-02 z8b9bve ?1e-o3 -? 3591 JE03 -,1231 ube-03-5 U19ZHE d7e-ob *6E weo E fe-05,2703 >1E-05 -, E *E01,1655 b9t*ol Z1E -64 b760e*ou -Sl ozlqc,oo t-01 -,? b1335e01-9 b?051e-oz -,3?761Ct E-Od t-oj :97 V,%%0*, t13* -,?l38s2l-0* til E-0* 56t1425E Q5 -,38* 816 E-0> -?61055E-OS, C(35 -loz513k-oy,3 SO016E01,165370E0] b7e -~+5610F+o0 -,189183E E01 -, E RIlq E02-3*5657 E-02,12nzonF02 -,38785 nf P Eo3, F L393E-oc E-05, E,3S -,20 E1527C-05 -,141167E E $IIE, C -,6499 E*o QSE E E C-OZ [-02-17a?3 E02 46!1954E03 l3n8f c03-406?l@f Z9E ?F+E ?E-05 -,13m163E UP 29 onoup 30 OROUP 31 OROUP 32 OROUP 33 OROUP 34 onoup s1904<01,16643 QEII -?25602E*o0 4*6r?2f boo -18q727E*o0 - FI 4797E-61 -,?6675?E qe-02 -,35 f,273e E C R4E C-04 -,le86b5e n+ -, 117@7fIE S -225!368[ C-O5 5q83113c*01, Rk E C Loo II -llm*nu oo -, E-7, R17L-01 -,%3 b73k-e? -2(36526L nl-03 -?73666E i2@+?15?l-@ SE-05 -,209165L03 13 S7JOC ble K S1713E-01,3b5966C E-OZ,2 E138S2E02,461663E02 360qOSE E-OZ E-02 58? 403E E & 90 f-02 27q523E02 OROUP 36 oroup 37 OaouP 38 OROUP 39 OROUP 40 mow 41 OROUP 4? S739E E E U6E01,5e89b5E ol,474619c E E t oi 2632 w7e ?5E-01, Q69363f02 i563n18e-az E-82 1 OZ665E-O E01 -,3677 bue OC-O1,429939E-02,S53034< E oz 6743: E02 -,47577 be ot -, S03289E-02,36582 qe-f12 433? 611C % Y/ o2 -,4 b78u7t-ot -,312660E02 zs8l728e E-O? *299 al E *E qoe-oz E qe-02,3 S944*E wk b533e02,1613 SIOE-02 n; 3877E-02 z237vve-02-33? 2651E-OZ F-02 no 18 E5zME t-oe -, E-02 no -,27u126E-oE 9576 q5e03 -, E:03 5 T9445C-01 2*7499E-02 Neutron ID = 85 Atomic N = 1, Table 4 onoijp I 8ROUP z mow 3 mow uP 5 OROUP 6 OROUP? 4,l?61740E02 :12 E750E qeol (3 Q Il OE-O C E-01,03$792E-01,278116C-01,2 M377E-01,76443w oe t o@ o;,148925e+1,977164e01,971750e E-o I SE OL -1? S037E-01 ii E R5E*o0 - I44108E-O1 -o b6f107@e E E E-01
15 OROU? n anew 9 OROUP 10 OROUF 11 IYROUP 12 O$IOUP 13 Onow 14 *?70M60E-01 llb66zf*oo -> O0651E E171,?65S70E-01 -a208bbzf-ol -179 z&bf E E b9b3k o13-2 S7192E-OZ -,411 S07E-131 -, L ZL a7l-nl t-01 -ll?51ee-171 : :38751 OC-O JW*O k-ol E!4E L l?65v5t Ol -12 U59W E-O k oz +41$ 17,0E E E*O E 32? 313Lo O L72E JW2->E-01 - no16nc ol RE > VE15ZE*O0-181 Z43E -:550 wleil f* -1*09?2E ZE01-91 Wl16< ,7r E J275E E E FEWC-01 -Om?qsc-ol *E oz -1690?OC-01,lb6607F ol -127?05E J7E? - II U5872--OI 2a67791E Rf E-02 -,174 &37t oz E-02 -,*39 WIW-02 -,7647 WE b21 E f WE-02 -, E S39E-02 wow 15 OUOUP 36 ORouP 17 OROUP 11 wow lq Onoup ZO OROUP 21!7 n: E* PE*oo f*oo -,207?36E l16708ebo0-755?93c-!?i -48 R5f01 -?q6 46?E-nl E L-02 - W,M7?f02-176?nbf-n2-109 R5PE-2 -,930389E E-03 ~ c W2445E3O 12h6bbE*ol *oo L SE*O0-04z515q L -Olq?oestooo -959,02k VIE+1-3 b13655t-7l -?2n703t-ol -,\ 792hk-01 -, M591?t -n? O?z?<??t 2 -,146 b36f-,12 -,lo739nt-n2 - Q1o O67E-O3-73 bb67t bol*oo -31 W60E E*O0-503 P03k-01 -,22695 LIC Ht-OL -,73 R903k k ~IWIk Mk-02 - M1H391t03 -, E310M6L-O3-3949k Z8k : Ib7B3bE Ell -,1oo751E*o C E u1z374e LE E O f02 3 b151j1f ? bje -02, E02 v630v t03,4 b?8?e-e, tde r, ne03,1446 /E o3,1225 YJE-03-9 W3VE04 ( C01 -llu711t*ol -1 O?090E O RIE OU -, t-01 -lb6063t-01 -,741113E oz LIC L3)! -,19 WIZ2E-OZ E-OZ -90? 5JIE-03 -,t,0h231k-03 15* b,7be03-17? 1ML-03 -l10330t S913E-0* E-0* - b51121e-0+ -,3631 b9e E a50e f ol C*Oi -291 a10c -,333311[ -5995E SE s[ W161E < R8[ he02-212?13c-02 -l?9z&?f-02 -, , )F-03 -t77267f-03,4 F7666E03 -,2hh1303t F125F-03-01uo07RE-03 -,?22215F-E13-12? 16?r c S6hf or6e-o &E *C MlE E-04 -,169337F-04 19s1,, < -q6910nt S359C04,7206E-OS E-04 -,610617E-OS E-OS OROUP 22 Onow 23 OROUP 24 OROUtI 25 OROUP 26 OROUP 27 OROW Q5E01 -,132273E*nl -12 S601E [ -,7 J19n58f rll -,1 R17 ElE ???E-n2 -,168467C- 2 -,770 P35E 3 36 Rh3r E he ,91 E-n re04-46 R913f,6-3n153+E-r ?7LIE b35?e,5-5, R776E-oS E-n5 -?64R01E-r13 -,?7$3*5E-05 -, E-05, 16%769<*o I *1 E*01 -, t* t*o0-7nn259t-nl se-131 -,662! 877t-q2 -l P8837t-n2-619?q3E-133 -,? P6936F-n J5L < 3 26t-13+,353 h87k ob t 4-16 Slfi&k-nb -lll~55t -O* 6, Eb47k-os -~15197E E bok35 : 16 S015E01 -,132809E*01 lzmlzt ol -,360 bbl L Bbt-0l -?19VIE-01, L t02 -, b93833t t-o3 -ln5+77t L F *E-04 - I194S131L05-60 b82tit t106e k e &f be C01 -l Z6WME601,3 b1011e 1 V9677E ?E-01 -, IIo6106E o2 - ZU!3337E ,2553 W2E03 L13BI< 4E be-04-1 L134it, E vbl-05 -* II fi+bl E zze-05 ZZ3&Otl E-05 lsoobje C* E01 -,127073E E no Jblnt ol -2z3b7E-01 0 R2J70bf-Od E-et k-Od -,3331 7?E E0* E-04,1629?bE-Ob -,67$ 609 E-OLI CE V15E!E S5E be c se e f ol W C E ,9E OZ 37 Flnn7E z4?e m-04 -l13276e-ob - S2b422E-05 -zb7rwe e-05 onoup 2? OROUP 30 OROW 31 OROUP 32 OFIOUP 33 OROIJP 34 OROUP 3s 7 lb5330c*o] E*I)1 -,362 a89e nob7n L!Enl -?26@74E-01 -,,53 b476e- 2 -,30 b221f-q2-112?95e-02 -, bln?n7e n3-1*71 E9 C E- -,16595?E-04 -,46n516E n e-q5,8642e*o0,30775 W, E131 -,+76 n5+tbo0 -l15i352t PE E-nl -48 Q071 E L-02-65!) 953t-03 -,?37506k-r73 -n529?8t -n* nlt04 Q208*IIE -OS L-rls :,134973C02,1674 u5f Z817E Z-02,337705E-Oa 2*3120E-ot ZL90490E-02, Eoz E02,254186E-02 31i4iS59E-02,557 S12E E E S133E-02 K 12
16 OROUP 36 OROUP 37 OROU~ 39 OROUII 39 OROuP 40 OROUp 61 OROUP 42 ssm35c- 2 7 SOb17E-nZ 3679 n9c-oz?06515[02 23z935E-nz ~, ~ e B786V?L0C ?E O1,6z79soE- z,@3n8zot ?5t E E-02 IS4095E01,145220L E-OZ 4 Z6W3EOZ 28 Qab6t-Oz Z122?3L E-oZ 1310 m0k-oz Z9195W01,137326f *S E02 7 M80MHE EJ<[-02,1768 ZIE-02 -O II II OJK YJE-OZ *C02 3?3163E E-OZ E-01 -,86 EM358C3Z -63 bv84e OX - I134215E V197E-Ot ve0e ae oz -30 Z637E E E E C03 E58zt17E n[ c02 2 Q5s71E-02 :21?26X R75F E02 l+79e8f02,136117[-0? 4 13
17 * DEUTERIUM (H2) Neutron ID = 6, I\tomic N = 1, Table 1 OUOUP 1 anoup 2 OROUP 3 b OROUP 9 OROUP T E*o a2e Izo ZO09S7E01 P r v * -,1824E?4nO132E*O0 lb3796e-nl t*o0 ;:177s6 7 L16201K*O E ?LK*OO * V5J8E 88385% oe oi Z099b5E 136 S70E a5b5do Eol 117?94C*O ZE*O1,13 M023C*O0?733131Z4,136752E n93093e-ol 5s979at-o I -798,? 25c C C C*O E ZE01 3az295f ol, E ? 973 E-01 16?92EE*01 36 b026e E*o ?E C-01,147216E*O se *E*O0 Onow a OnOuP \ OROUP 10 OQow 11 0RO13P 12 OROIJP 13 OROUP bc n7e01,209088e 3613 S3f* ab91720e-,tl b10531e-01,22 bt7n7f oo E IS8564E-01,161416c ],Z7E f-05 Z7E-05 Z17975 Enl E E ?E OI lej737wboo 1663 Jbf E E 4517 d0e Ianhzbt oo beb d8b604e+o0 65ql 70E ZIW,1592 hmfb 16 V141t*oo L01,loo of boo 13n4s9L Elo C*O0 llj32ybe*oo 2 P7144k- 1 *399 J%E01,b19nb3E ol 267? 2SL-01 3$a979L ol,5 Z12r Hf-01?6b E07k-01 3 U0946C ue E-01,lZ7916E-01,Z153*W EOB o:2,9505e,oi, C E C*O0 35!1503E 2676 V3E Zbb86UE IWZ920E*O0,lzQznolE ol 232 be E OJ alo OoOc C01,338z23[ r EoO0 b50356e E E OO Zb43 34E SE-01 -,* OOOOOEOS hE ol 39?243E,7 S7050C E,55 Q310E OO, C E zlan&sc*oo 2 Q7193E-01 OnouP 14 OROUP 16 OROUP 17 OROUP JP19 OROUP 20 OROUP 21 -,21 OOOOE-OS E Q3?<*O0 90 i55c 697? 14E*o be oo 538 F!WlE E110 b51613f-01 - II41OOOE-OS 2460E E E E-05,6730 E05, E~Ol C E C01,3b2z90c01 34z311E oi, e*o I,160551E $?E01 14$17W*01,1627 R7E,01 lb3095c qk nl [ J5E E*01,152555E01 IS3040E wf* E 5024f * 454? 50 E*O s F*O ?f ol, E i?30z31e ol z9bb41e-oz,135n754c02 0a9i13E+2 52nz59t*,418069k-01 E52663E-171 onoup 22 OROUP Z3 OIEOUP 24 0!70UP 25 OROuP 26 OROUP 27 OROuP Zn -, Z4E C-OS,3*23 b7f ol oe*o I E nl E*01 1 S2802C*OI E01 4 S5854E,455366E 595 &22E-02,a78078E-02 - Z7907 O5, E01,142606E E01,455365E,8 EIJ716E E E-oS -,e13aoe-os,342303t1,3* Z302E01 3 bz35c*ol,142959e01 14 Z9+1E01, E E01 15 Z811Eb01,152907E01 4 S5106E OO,+55011E E 8769 Z7E-02 EJ534r*E E-On -20 C-05 34?331C be bne ol, 65 EA86E*O0 917 E45E-02 llnnljp 2* onnup 30 OROUP 31 UR17W 32 13nuuP 33 oaoup,54 cmnup 3~,710~63c-14,34231 W* C W*01,15 Z754E*171 36n151t* S9E EIJO E,@Bo888E t-02,313@ J6c-oz C-OZ?7@7tbC-02,60131 )E01 lb9a*oe oz Z83e13C-02 z*1319f Oa 201n47r-02 lii065?c-oz E-01,71361 *f ol,7 WL710EO t-0< SE-OZ C OZ 3 M365E-Oa LEE-OZ E-02,za7350L om fOZ E-02,466754C E E-OZ OUOUP 36 onoljp 37 orow 38 OROUP 39 omoup 40 Onoup 41 OROUP *9E-OZ q13z06ele 1 S0735*E-OZ n91808e02,6 Z8827E-r12 b9f58be-17z 7b0966E-03 I055117E*o0 953 bl19t-rz E-01 n96934t-m? 689 b94e-n FI1E-O En E E-02 fl 9 b13+54c-r E Q567C 1813 *ae E-01,13 Q9b Mt-ol,1046 O3K-O f EOZ bl Z740E-02, L-O2 b191b UE E, E01,4363 <*E01 zb20z2e AE V3E-01,12 Wbl E-01 I1l+IJLIE-01 V@38t*t-02 a81519e-02, E-OU,Z44621E 887 Z08E-01 6 Z7437E L V2QbE-01,2z07E L1662E01 16 N114E-01 1 S76U3E L01 1 S0314L E f ?E,1559E*O0 63 R2119E W76E-01, E bf19~e E-01, 1338zt, F-01 l15712f-ol,i0191qe bf bs6c-03 5 S7751E 557 W5E E-01 14
18 Neutron ID = 6, Atomic N = 1, Table 2 OROIIP 1 OROU? 2 OROUP s OROuP 4 OROUP OROUP & onoup 1?03:1C01 7: * ~ 1463C s6TE on, E,7393 WE C01 17 W+5C E*OO tol C*O0 2 Z2286C4 8 L19135E-01,513 Z60E01?b8138E ol 3 a i:,12 W22E*O E 64(2559K01, F01,1338 z2e E E*O0,378036c Q12532E C-O1,56671 le ?6C E5L732E-03 OnolJ* a OROUP 10 OROUP 11 OROUP 12 OROUP C OO E,21J771?f01 66q?37E 2 -?97479c E E E-02 ~,,190687E b11960c E-111,6665 SO< *5E-02 -,l12776t-ol E C- I -,17? 965E-nl El 1631 aoe Oo 4114 LlaEo O 1452 ME*O0 2 Y9389t @ 337E C-01 -z42769l k01 -z91463e t *8E J54*JOE oe*o O If-o: c02,z5f17&3E E NE E V JE nlbe Lll 2126 fve J32ZE, E*O E*O0 7772E-01 -,39532 EIE-02-71t1013VE-01 -,] IE z93e*o0 -,74626 SE-01 -,?li14*5t-ol -,127066E-OJ F*O E*O0 ;1072V?E OO E02, B37555E01 l&1173c oo,15 E267C E-01 32?814C,406425E 61181?E E -021@ *311E*o E E E-01 0RO13P 1s OROUP 16 OnouP 17 oroup 18 orou? lq OROUP 20 OROUP E*o C-01 -O?11P91CO E -2 S4W15E SlE-01,925647E t*o t *nn RC*O E*o0-7 Qc25W-01 I03191E E 10485VE *01 3 W30J2E E*O E,3 b0727e*o0 -z144/q E fol I05288C*OI E O1 35 J906E*O E -?42462E*O E -8 Z346SE-02,791145E E o C*O0-26? 3~6E*O E-02 OnouP 22 enow 23 ORouP 24 OROUP 25 OROUP 2* OROUP 2? OROUP 20 M ln521aeool 3 S6130C -,242407C*O0 -,(12 $367E02 I05242E01 3 S*388E*n OOE*OO -!30E@27E O6E*O E Z62026E*O0 -,807713C C*O E*OI 1 OS019E O EOO E C*O0,2421 <i?e*oo -?*2*09E*O E YOE02 -,8zQ052E-OE $2E E*O1 355 R72C E*O0 -,5446 zoe-02 OnouP 29 WOUP 30 OROUP 31 (EROUP 32 OROUP 33 onoljp 36 OROUP 35 I05312E$ E* E I03406E*o0-26? 262E*o0,249160C -o@11299e M50E-02,136236E-oZ :, 1696 Q7E-02 2a1644E t-02 J51539E OE 2832 *3 E-OC E O]lC O b9f02 221Q774E E E02 b55174e E E-02 OROUP 36 OROUP 37 OROUP 36 ORouP 39 OROUP 40 ORouP 1 onoup u J! ~o a,,~4n826e-02 i23e55l t+7 6 b?*68t-n E-n2 b34n31e-nz 374 bs7k-02,176363e-01 Z01576E-01,123E21E01,925420E Eo Z E-02, t E-02,43a6tllJE ol ue-01 20s81 Wol 1*3991 O E-01 9i E13W E c b0f E of-ol E-01 9 Z3+55E OZ 66&3 +OE-OZ E-OZ,4 Z6993E-02 3b165b E Jnt-02, E-OZ C-01, E02 _,165Q39f01-12Sbb7E [ beoz,668562e OZ of o2 -, E-02 -$ E E E-01 - W0806E-02 d 15
19 Neutron ID = 6, Atomic N = 1, Table 3!lRoIJP 1 OIIOUP 2 OROUP 3 orow 4 OR(JUP 9 OROUP b ono(jp 7? 134 I1OC+1 9 l11394e nl 9618 V3E LIZC E C E c01 53? 76E we-01 L B755E MOC,217130E-01,] I10796EoJ E-OZ Onow a OROUP 9 OROUP 10 OROUP 11 OROW \z,9195 no E QoE 1402 h6e-oz -12z6E-01 - I18b56C C02 OROUP n2c*oo 1712C -Z3230QE C-01 -oz03717c n05e-ol -ST6107E-OZ onoup ,7 a9e LlL E, W-01 -z23nn6t e-01 -, f e-n2 -z99r69c112 : a ZE OO,197756E,139072E*o ae oo a3f-01 -, E-fil - Z166Z3E-01 1!:!:! -9 b9z2st n L-OP :1:!E3A6E E*O ZE OZ,6,? 69711kol o8e-oi E E k oz t-01,Z29063E Q1?E-o Z 5212 Y~E ,?34717E-01,634705E-03 z?7535e-01,z707z/e01,15 MYME-01,20636 ve ZE 141! 892E -n9b660e ME -l Z5b93t* E E-01, t-0l,lm1906e-oi C Z470E c Q37z Oo -, [ ?E -,4 is42q E-01 b77037e01 Z630917Z-01 Z09344C*O E E*O0 -o Z15994E*O C E01 l15p2te*o0 z370sie-01 Onou? 15 enoup lb Onou? 17 tlroup 10 oroup 1s OROUP ZO OROUP 21 z62551e no - E19aslz E-r, E*OO -,1737 b7e, r no lb6702e*o0 5z553nc ol r 4691JZOEIJO E1E -*99997E oo ne L193E*o E-01 S220WC*O E*o0 -, b5131k-01, L, E-01,533152E 35 SS69E E-01,16997W01 53*760 C E*O ME-01 7*5053C OZ 53 S031C*O Eoo RC01,712633COZ 53 b8z6cbo0-3 S6259E*O E01,735226E02 OROUP 22 mow 23 Onou? 2* Onou? 25 Onou? 26 OROUP 27 onoup Zn n- n; s3b179e*oo -, E* 140? 37E-nl E n2 O#olJ* C E 14c040E-01?27425E-nz a - 53*933C*O C*O E ZE E*o0-35 S7JOE*O0,137 be ol E-02 - s34b67c E 13 b*91f ol,73957 ee OZ 6; 53sl&7c oo -35 bm5a Eoo E E E*o E*O C C02 OROUP 30 OROUP 31 OROW 32 OROUP 33 OROUP 36 OROUP 3* 53$719 cf313-3 S59417C*OL E-nl E-02 f L-02,16136 ble C-02,215170E-OZ 3b5966E-#z,275104E-OZ :,203m5zE E-oz E E02 a ;391316E E b66e E C-02 OROUP 36 OROUP 37 OROUP 38 OROUP 39 OROUP 40 OROUP 41 OROUP 62 a 5739C-02,8277 E-IIZ E-02,429939E02 345@ ZSE-02,2 S2E20E02!3 b a 9155E-02 llsmnt-nl?56468e-oz C-02, E-n E-n2 30 Z61W-OZ E E-01,102645E-nl 70603W-OZ OZ E-OZ 35 W44EOZ 308 E77E-OZ o; i: 3742 ubf-01 5$ B965E-01,+74619E01 2b3297E L E-o Z s-01 -w1776me-oz - I03z90E E Z*E E9E oz,4 b31v7e-o Z -4*7 EI17C-OZ -312 b&o EOZ,3b617*E we O>990E-OZ b5j3e-oz E-oZ -,165510[03 2 Z37WE-02-33z?bEE-oz E-02 Innsziw oz *3E-OZ -11 Z291E-02-27t IZ0E-OZ E E-03 O* %5794 ~lle01 2 b7499e02 16
20 Neutron ID = 6, Atomic N = 1, Table 4 OROUP 1 onoup z OROUP 3 OROUP OROUP 9 OROUP b OROUP zoC-02 bl R470f-n2, E-111,lSIJ630f-01?936J8E E-o?,2 L2350L ZOE zbf E E E E-01-3 F86E01 z386a7e-ol 678z710E01,366936E01 -, W7848E-01 -,246 n4qe ne ol -,742 bb9e-oz 1 Q64F*O E C-01 -z64703e n20c oz Q7E E-O2 OROUPa onoup Q EIROUP 10 mow 11 oroup 12 OROUP C01, E OZ ae co z FIE-oZ E-02 b2570b En2 60 E1140E-oZ E E-01 5$3930c C S96E E we <-01 66tJ701C Q25E VVE OO -,197164E L-712 -,35 R770E-01-61n35bE01 9>503ZL-01,E37241E IIz,11474 LIE >1 C b3n9e E-F1, 1225s5E-nl,211338[ RE-01 Z96066E *0f-01 7 ZZ316E ~12E not-01,671377e-oz -,3718,2c oz?6!jzu2t ol t Z7Z*E02 -, 1905wIE f t ie JE-03 cl -o199721e ?ZEL71 -,177156F -1337,0 =E,S56819E O? 1 O1686E OO I17170E*O E E n16E-ol E+o le ?E*O0 01S2566C E41 51 Iy onoup lb OROuP 17 OROW It OROUP 19 ORouP 21 El l16179c* -2 Y?959C -835 C53E !2C(70 6 W947E01 -?*3h7bE-ol E01 OROLP z? 11?318E R8t,1083 f10e*o0 20@27E,0n -3 S6*70E me-ol OROUP Z3 I*4860E E 177 Q83E*O G01-2 C3622E-01 OROUP 24,14 W38E -01 E136Z6E* 652 S11E E41 OROUP 2s,1696 b4f WE*O E-01,63 M698E oi! OROUP Zb C805?E 150 bolc017 l 66357?F SC OZ OROIJP E*o0 -laa905e Oo E E02 OROUP C0(3-1 E7923Eoo E-01 -,62646?E n2 ~ 16 W63E*O E*O E- ~ -,61 EJOloE-n2 I! oomc oo -1 EJ8104E*OO E-01 -,617067f-oz E -l Eins6vEeoo 6679 cve01-6 Z06W1OZ,l*9915f oo -18 M+b7E* 66 V160E E-oz OROLIP Z9 OROUP 30 ORouP 31 OROUP 32 OROUP 33 OROUP 34 OROUP Q5*IE*O0-186 z67e*o E E-02 r COZ lb74u8e-oz Z7Z877E,Z13Z51C-OZ E-OZ,Z631Z6E-OZ 55751,?E E E-o Z E-02 OROUP 36 onotjp 37 Onow Ja OROUP M onoup 40 OROUP 41 OROUP 42 QZ Z80b90E-02 4 Z7LIS4E-OZ E OZ Z54186f-OZ Sf O2 7 S0617E02,5nz407Eoz 367 Q89E-02 Z136S15E-OZ 23 ZQ35E-02! 13 Q W849Z[-OZ I046Z?E01 62? Q50E L18?oC-02 3 Zl175E-r2 ZS3159E-PZ SCE E SZ?OCO; 7095E-02 4 Z69V3E-OZ 21391!66E-oz Z122?3E-OZ E-OZ E-OZ z91952e zee-ol 17 b36ve-oz -70 RowJE te-02-17t9d1e-0z -,lelo3de Y+E-02 - I?1460E-oz 3 Z3163E-01 - C37+13E-OZ C-01 -,abe05 E-oz -65 EWQE-04 - S36275L-04-04c +1 47E-02-3 R703 i E JnE-oi -30 Z637E-OZ E-01 -ol198m3e z87E-03,31253 PE-OZ E C5571F F-OZ,1 S5E75E-02,16+ Q03E-02,147 QMFOZ E-02 bs8b66e-oz E-03 17
Tamil Nadu Public Service Commission
ASSISTANT CONSERVATOR OF FORESTS DOE :02.12.2014 TO 09.12.2014 _ Subjcct:AGRICULTURE ~ Codc:ACFAG ~........ B X 41 AX 81 DX 121 o A 161 c l< 2 cy 42 CY' 82 Dy 122 13 x 162 B ~ J ox 4J c \ 83 D..( 123 c
More informationSurface Mount Transient Voltage Suppressors. Peak Pulse Power 400W Stand-off Voltage 5.0 to 440V
Features Plastic package has Underwriters Laboratory Flammability Classification 94V-0 Optimized for LAN protection applications Ideal for ESD protection of date lines in accordance with IEC 1000-4-2 (IEC801-2)
More informationTable 1d - FSA for All Returns, Females Tax Year
PR 10 Newfoundland and Labrador A0A 20,250 597,345 1,920 1,720 2,580 3,150 1,960 1,610 1,360 1,030 1,020 740 550 460 630 470 410 290 290 70 20 A0B 8,850 249,804 780 740 1,200 1,520 1,010 790 540 430 370
More informationGenuine Metaris Gear Product Technical Catalog. Pumps & Components - MH Series Bearing & Bushing Style
Genuine Metaris Gear Product Technical Catalog Pumps & Components - MH Series Bearing & Bushing Style www.metaris.com MH365 Series Bushing Pump Features Metaris Bushing Pumps & Motors are available in
More informationGROUP SIX Mficoticari Emoteq Division MF Series Torque Motors - Thin Ring Design - Direct Drive eliminates backlash - Extremely low cogging torque Con
GRUP SIX Mficoticari Emoteq Division MF Series Torque Motors - Thin Ring Design - Direct Drive eliminates backlash - Extremely low cogging torque Contact Us! Email Purchase Source: GRUP SIX () Te,4,2t
More informationEffective Date: June Rev. 7/20/2017- Void After: June 2018
IAPMO Research and Testing, Inc. is a product certification body which tests and inspects samples taken from the supplier's stock or from the market or a combination of both to verify compliance to the
More information* * 5000 SERIES * * * * ENGINEERING CODEBOOK * *
* * 5000 SERIES * * * * ENGINEERING CODEBOOK * * THROUGH THE USE OF THIS CATALOG ALL THE COMPONENT PARTS OF ANY PERMCO PUMP OR MOTOR CAN BE DETERMINED EXCLUDING FASTENERS. THIS IS A CODE BOOK FOR THE 5000
More informationGrade boundaries June 2018 exams. GCSE Reformed (subjects which use the 9 to 1 grade scale)
Version 1.0 Grade boundaries June 2018 exams GCSE Reformed (subjects which use the 9 to 1 grade scale) This document presents grade boundaries for the new reformed GCSEs which use the 9 to 1 grade scale.
More informationNo January, Eaton. Dual Self-Level Valve. Parts and Repair Information C D. Model XXX
F Eaton No. 06-530 January, 000 Parts and Repair Information D Model 39055- Solenoid Valve Optional 4 34 Nm [5 lb-ft] 34 Nm [5 lb-ft] Solenoid Valve Optional 4 or or Unloading Spool Raise 4 3 8 6 7 7 8
More informationCompact cylinders series NYD Double acting with magnetic piston, ISO M5 to G1/8 Piston Ø 20 to 100 mm
Compact cylinders series NYD Double acting with magnetic piston, ISO 21287 M5 to G1/8 Piston Ø 20 to 100 mm 200, 210 220 600, 610 620 Order code NYD-032-125-210 High force cylinder series NYDK and multiple
More information* * 124 SERIES * * * * ENGINEERING CODEBOOK * *
* * 124 SERIES * * * * ENGINEERING CODEBOOK * * THROUGH THE USE OF THIS CATALOG ALL THE COMPONENT PARTS OF ANY PERMCO PUMP OR MOTOR CAN BE DETERMINED EXCLUDING FASTENERS. THIS CODE BOOK IS FOR THE 124
More informationBREAK-EVEN SELLING PRICES FOR WINTERED AND FED CATTLE
BREAK-EVEN SELLING PRICES FOR WINTERED AND FED CATTLE EM 3909 JUNE 1975 COOPERATIVE EXTENSION SERVICE COLLEGE OF AGRICULTURE WASHINGTON STATE UNIVERSITY PULLMAN In cooperation with the United States Departent
More information1700 Loader 4 Cylinder 91 & 104 C.I.D. 6 Cylinder 122 C.I.D.
Owatonna Parts Manual 1700 Loader 4 Cylinder 91 & 104 C..D. 6 Cylinder 122 C..D. Parts Manual THS S A MANUAL PRODUCED BY JENSALES NC. WTHOUT THE AUTHORZATON OF OWATONNA OR T S SUCCESSORS. OWATONNA AND
More informationSMB5.0A(CA) - SMB440A(CA)
SMB5.0A(CA) - SMB440A(CA) SURFACE MOUNT TRANSIENT VOLAGE SUPPESSOR DIODE VOLTAGE RANGE: 5.0-440 V POWER: 600Wa t t s Features Mechanical Data Glass Passivated Die Construction Uni- and Bi-Directional Versions
More informationGeneral. Principles. 3-Trapped Key Switches. 11-Cat. No. Index. Logic. Power. Safety Switches Trapped Key Switches Overview
R Safety Trapped Key Overview Key Coding Below is an example reference guide that is useful in selecting and tracking codes. Start down the Aa column as the lower codes (typically Aa to Za) are stocked.
More informationPneumatic cylinders, piston-ø mm Double acting with magnetic piston DIN ISO 15552
Pneumatic cylinders, piston-ø 32 100 mm Double acting with magnetic piston DIN ISO 15552 Technical data for series SL 050 450 Order code SL-032-0250-050 Series Piston-Ø Stroke length (mm) Type of cylinder
More informationZ SERIES Z22 TECHNICAL SPECIFICATIONS. Hydraulic Pump/Motor Product Group Roller Bearing Design
Z SERIES Hydraulic Pump/Motor Product Group Roller Bearing Design Z22 TECHNICAL SPECIFICATIONS Replacement parts for industry common pump/motor series. Assemblies are built to match your replacement or
More informationHEAVY DUTY PNEUMATIC CYLINDERS
HEAVY DUTY PNEUMATIC CYLINDES Features: Conforms to ISO:30 standard. Double Acting, with adj. cushioning at both ends. Sizes: Ø, Ø, Ø, Ø, Ø, Ø0, Ø1, Ø0, Ø0 & Ø0. : Other bore sizes on request Seamless
More informationJOB LOSSES BY STATE, State Industry US total AK AL AR AZ CA CO CT Agriculture, forestry, fisheries -15, ,
State US total AK AL AR AZ CA CO CT -15,597-35 -272-248 -232-3,163-132 -46-3,858-68 4-19 -291-303 -116-11 -3,318-9 -55-32 -73-314 -66-35 -554,750-194 -14,113-7,789-4,781-55,255-4,453-6,836-9,326-13 -190-282
More informationFedEx Express Rates. Effective Sept. 15, 2008
FedEx Express Rates Effective Sept. 15, 2008 Table of Contents FedEx Express Intra-Canada Rates 2 Postal Code Index 3 FedEx First Overnight 4 FedEx Intra-Canada Index 12 FedEx Priority Overnight 14 FedEx
More informationZ10 & Z16 TECHNICAL SPECIFICATIONS
Z SERIES Hydraulic Pump/Motor Product Group Roller Bearing Design Z10 & Z16 TECHNICAL SPECIFICATIONS Replacement parts for industry common pump/motor series. Assemblies are built to match your replacement
More information$36 for Jiffy Lube Signature Service Oil Change, Tire Rotation, and Rain-X Original Glass Treatment (Up to $73.97 Value)
49382 NZ $36.00 70481926 49383 XC 49384 MY 49385 ME 49386 FV 49387 FK 49388 SV 49389 KF $52.99 84250649 49390 BG $51.00 34663816 49391 DV 49392 DA 49393 HD 49394 TE $37.00 24551795 49395 IP 49396 XR 49397
More informationSAMYANG ELECTRONICS SMBJ SMBJ440CA TRANSIENT VOLTAGE SUPPRESSOR. Features. Mechanical Characteristics
SAM YANG SAMYANG ELECTRONICS TRANSIENT VOLTAGE SUPPRESSOR BREAKDOWN VOLTAGE: 5.0 --- 440 V PEAK PULSE POWER: 600 W SMB (DO-214AA) Features Working peak reverse voltage range 5.0V to 440V. power dissipation
More informationCSc 466/566 Computer Security
CSc 466/566 Computer Security Assignment 2 Due Noon, Feb 20, 2013 Worth 10% (ugrads), 5% (grads) Christian Collberg Department of Computer Science, University of Arizona Copyright c 2013 Christian Collberg
More informationTC +I- DIP - REF - SD +/- Ho Hc INT BYGRAVE D. If DEC contrary or W < LAT Zn= Az Zn= Az. If DEC or W > LAT Zn= Aa Zn:180 - Az
DR Lat Watch we +/ Zne ime ZD +l GM DR Ln Date Date Hs C + DP REF SD +/ H Hc N t6 (strn ONLY) /A Zn BYGRAVE D SAR Name GHA Aries lt mnth ncrement, days & hurs * ncrement, minutes & GHA Aries SHA GHA star
More informationm ,416 ~ 7 156,745 7 ~ 167,074 t-;'i4
FORM L5W REV #2 7J9S 4:ti( ';t!il BARGE CBC-7035 NAGE TABLE PORT OR STAR 0 2 t-lli..!!! jg tirl!i r0 r' jq. r..lli r! * 68 --'.. 880 ri,079,278,478 r-j..,759 ri 2,040 2,322 4,22 fl! 4,549 4,878 5,205 2,603
More informationZ SERIES. Z32 Technical Specifications. Hydraulic Pump/Motor Product Group
Z SERIES Hydraulic Pump/Motor Product Group Z32 Technical Specifications Bushing Design Replacement parts for industry common pump/motor series. Assemblies are built to match your replacement or to meet
More information10/97 N Our policy is one of continued research and development. We therefore reserve the right
ISO Cylinders Magnetic Piston Double Acting Ø 10 to 25 mm Magnetic piston as standard Conforming to ISO 6432 Corrosion resistance Buffer and adjustable cushioned models Supplied complete with nose mounting
More information2. COMPACT CYLINDERS series STRONG (RS, RQ)
2. COMPACT CYLINDERS series STRONG (RS, RQ) A new series of compact cylinders for long s and heavy-duty applications standard supplied with oversized guides and rods, the first one with adjustable pneumatic
More informationSMB. Features. Mechanical Characteristics. Maximum Ta=25 unless otherwise specified. Peak Pulse Power Dissipation by10/1000μs Test Waveform
KLS5-SMBJ Features SMBJ Series *600W peak pulse capability at 0/000μs waveform *IEC 6000-4-2(ESD) 5Kv(air), 8kV(contact) *Quick response to surge voltage *Excellent clamping capability *Typical failure
More informationTie rods cylinders to ISO standard
Tie rods cylinders to ISO 5552 standard seriescpui DESCRIPTION Cylinders series CPUI comply with ISO 5552 standard, being in this way completely interchangeable with the well-known cylinders to ISO 643
More informationHYDRAULIC HEAVY DUTY
Catalog #HHD-16 12/16 HYDRAULIC HEAVY DUTY Series HHD 3000 PSI RATED 10-25-16 WARNING IMPROPER SELECTION, IMPROPER USE OR FAILURE OF THE PRODUCTS AND/OR SYSTEMS DESCRIBED HEREIN CAN CAUSE PROPERTY DAMAGE,
More informationStars or starlets? Competitor overview switching devices. Only for internal use. sirius IN COMPARISON
Only for internal use Stars or starlets? Competitor overview switching devices sirius IN COMPARISON Who are the real stars? The comparison. Under ideal conditions, the human eye can make-out approximately
More informationZ SERIES. Z40 Technical Specifications. Hydraulic Pump/Motor Product Group
Z SERIES Hydraulic Pump/Motor Product Group Z40 Technical Specifications Bushing Design Replacement parts for industry common pump/motor series. Assemblies are built to match your replacement or to meet
More informationLIFTING CHARTS - Crawler Cranes AMERICAN MODEL TON CAPACITY
LIFTING CHARTS - Crawler Cranes AMERICAN MODEL 7260-100 TON CAPACITY 7260 1 LIFT RATINGS with 59S Tubular Chord Hammerhead and "S-S" Counterweight (49,700 lbs.) (15,150 kg.) (Feet) Feet (Pounds) Feet From
More informationdjangoproject.com skillsapp.com for invite)
DATA DESIGN MEANING djangoproject.com skillsapp.com (tweet @skillsapp for invite) VISUALIZATION SRSLY, GUISE DATA? PROFIT MEANING! acquire parse filter mine represent refine interact acquire parse filter
More informationControl Units Ex e Glass Fiber Reinforced Polyester
Features Assembly Glass fiber reinforced polyester (GRP) enclosures Suitable for operation in Zones 1, 2, 21 and 22 Certified Ex de, Ex ib and Ex tb Up to 4 operators per control unit, base-mounted contact
More informationINSTRUMENT PANEL CLUSTERS
INSTRUMENT PANEL CLUSTERS NOT BUYING AT THIS TIME REVISED ##### PART # MAKE APPLICATION 6/18/2018 PRICE 56045618 CHRY IPC 40.00 56045679 CHRY IPC 40.00 56051103 CHRY IPC 40.00 56049833 AC,AD CHRY IPC 40.00
More informationHYDRO-PNEUMATICS. 1) Hydro-Pneumatic Tool De-Clamp Cylinders PCS Series ) Hydro-Pneumatic Intensifiers for Machining Centers... 1.
HYDRO-PNEUMATICS 1) Hydro-Pneumatic Tool De-Clamp Cylinders PCS Series... 1.310 2) Hydro-Pneumatic Intensifiers for Machining Centers... 1.330 HYDRAULIC CYLINDERS 1) LH7 Series... 2.110/1 Std. Mounting
More informationGeneral Principles 9-3-Trapped Key. Switches. 11-Cat. No. Index. Logic Power Stainless steel construction.
Safety Trapped Key N precision cut keys Interlocking and ontrol Solutions Trapped Key Interlocks Why Use Them? Based upon the premise that no one key can be in two places at once, key interlock systems
More informationSMA6J5.0A(CA) - SMA6J440A(CA)
SMA6J5.0A(CA) - SMA6J440A(CA) SURFACE MOUNT TRANSIENT VOLAGE SUPPESSOR DIODE VOLTAGE RANGE: 5.0-440 V POWER: 600Wa t t s Features Glass Passivated Die Construction Uni- and Bi-Directional Versions Available
More informationAIR CYLINDER Series A23, A24
A23 - Magnetic A24 - Non-magnetic Double Acting s (Square type) Ø32-125 mm As per ISO 15552 / VDMA 24562 standards. Features Adjustable cushioning at both ends with elastomer pads Wide varieties of mountings
More informationSENTRON VL Series Product Specifications
SENTRON VL Series Product Specifications VL 400 Frame 400 s Electronic Releases ETU TRIP RELEASE 315 12-315 3VL4731 - A 3-0AA0 400-400 3VL4740 - A 3-0AA0 3 = 3 poles All VL400 circuit-breakers are shipped
More informationSeries 83. Stainless Steel Mini Cylinder
Stainless Steel Mini Cylinder Magnet included in 7/8 and 1-1/4 bore only in double acting cylinder THEORETICAL CYLINDER FORCE (LBS). Operating Pressures (PSI) Size Action 25 50 75 100 125 150 3/4" Out
More informationTORC.COM TORC. Innovative Torque Technology
h i m e u ng ha l ch an ite sa es nd im th a n ds d c h f s f ite l e u ge fr lea ig as ree d c h im sa s ee ra hfl t s bo lea ch an ite fas bo nc ow wit lt ra d c hi t lt e p c in n a d he ng s f l gh
More informationAPPENDIX A Instruction Set. Op Code. T states Flags Main Effects. Instructions
APPENDIX A 8085 Instruction Set Instructions ACI byte CE 7 ALL A A + CY + byte ADC A 8F 4 ALL A A + A + CY ADC B 88 4 ALL A A + B + CY ADC C 89 4 ALL A A + C + CY ADC D 8A 4 ALL A A + D + CY ADC E 8B 4
More information107 SERIES PSM. DIN2353 Threads DIN2353 Bulkhead DIN3852 BSP/NPTF/ORB
107 SERIES PSM DIN2353 Threads DIN2353 Bulkhead DIN3852 BSP/NPTF/ORB Manufactured according to ISO 7241-A and ISO 5675 norms. Poppet Valve or Ball closing system. DIN2353 threads. Other threads available
More informationIAPMO RESEARCH AND TESTING, INC E. Philadelphia Street, Ontario, CA (909) Fax (909)
IAPMO RESEARCH AND TESTING, INC. 5001 E. Philadelphia Street, Ontario, CA 91761-2816 (909) 472-4100 Fax (909) 472-4244 www.iapmort.org CERTIFICATE OF LISTING IAPMO Research and Testing, Inc. is a product
More informationMultiplication Tables of Various Bases
THE NUMBER BASE 10 100 Ternary (Base 3) 1 2 10 2 11 20 10 20 100 Quaternary (Base 4) 1 2 3 10 2 10 12 20 3 12 21 30 10 20 30 100 Quinary (Base 5) 1 2 3 4 10 2 4 11 13 20 3 11 14 22 30 4 13 22 31 40 10
More informationAS/ASH SERIES ALUMINUM PNEUMATIC AND HYDRAULIC CYLINDERS... 6
AS/ASH SERIES ALUMINUM PNEUMATIC AND HYDRAULIC CYLINDERS............. 6 Section 6 8 ORDERING INFORMATION For Rod End Dimensions see back cover foldout... Basic Cylinder No Mount.0" to 4.00" For pressure
More informationPR I CE 'I S T N o. 'AYS ' NET 60. Com p l ete. 6 j AN UARY l st, ' 40 Mirrors. 200 Panel doors ' 50 Mirrors ' 50
PR I CE 'I S T N o. 6 6 ACME KITCHEN FURNITURE COMPA Chattanoo g a, Tennessee Wardrobes Chifiorobes 2 200 Panel doors NO. 19 201 202 12 ' 40 Mirrors 203 l doors Pane 204 12 ' 40 Mirrors 205 Panel doors
More informationDelta Power Company 4484 Boeing Drive - Rockford, IL 61109
VALVE CATALOG MAIN INDEX RELEASED DATE: JUNE 03. QUICK SELECTION GUIDE Page SOLENOID OPERATED DIRECTIONAL CONTROLS (See ENGINEERING DATA for coil specs) Page 7 MECHANICAL DIRECTIONAL CONTROLS Page 5 PRESSURE
More informationAIR CYLINDER Series A75, A76
A76 - n-magnetic A75 - Magnetic AIR CYLINDER Round s - Ø32, 40, 50 and 63 mm Double Acting with Adjustable Cushioning Features Available in magnetic and n magnetic version Adjustable cushioning at both
More information~... se_rv_ic_e M_A_NU_AL_2_44_4._z1,~
WABCO... se_rv_ic_e M_A_NU_AL_2_44_4._z1, DN-11 DC NEUTRAL RELAYS PARTS LIST This service manual provides parts lists for 4-, 6-, 8-, and IO-point DN-11 DC Neutral Relays. Included in this Parts List is
More informationAIR CYLINDER Series A12, A13
A12 - Non magnetic A13 - Magnetic S Double Acting ( Ø32-100 ) mm As per ISO 6431 / CETOP RP43P, RP53P standards Features Adjustable cushioning at both ends Wide varieties of mountings Low friction Long
More informationGeneral Principles 9-3-Trapped Key. Switches. 11-Cat. No. Index. Logic Power Stainless steel construction.
Safety Trapped Key General Principles 9-3-Trapped Key N precision cut keys Interlocking and ontrol Solutions Trapped Key Interlocks Why Use Them? Based upon the premise that no one key can be in two places
More informationPRODUCT GUIDE LANDSCAPE LIGHTING. fxl.com. A Hunter Industries Company
PRODUCT GUIDE LANDSCAPE LIGHTING A Hunter Industries Company fxl.com FINISHES Metals Powder coat Standard Powder coat Specialty s AB on copper AB on brass AT on copper AT on brass CU BS SS NP BZ DG WI
More information103 SERIES ISO-B CARBON STEEL / AISI 316 / BRASS
103 SERIES ISO-B CARBON STEEL / AISI 316 / BRASS Manufactured according to ISO 7241-B norm. Poppet Valve closing system. BSP, NPTF, SAE/ORB threads. Other threads available upon request. Materials CARBON
More information400W, 5V - 188V Surface Mount Transient Voltage Suppressor
400W, 5V - 188V Surface Mount Transient Voltage Suppressor FEATURES Low profile package Ideal for automated placement Glass passivated junction Excellent clamping capability Fast response time: Typically
More informationMCC omponents Itasca Street Chatsworth
omponents 21201 Itasca Street Chatsworth!"# $%!"# SMBJ5.0 THRU SMBJ170CA Features For surface mount applications in order to optimize board space Low profile package Fast response time: typical less than
More informationCylinders Series 61 - Aluminium profile
CATALOGUE > Release 8. Cylinders Series 6 - Aluminium profile MOVEMENT > Cylinders Series 6 Single, double-acting, magnetic, cushioned ø 32, 40, 50, 63, 80, 00, 25 (ISO 5552)» ISO 5552 (corresponding to
More informationRegulator Rectifier. Pick-Up Coil. Ignition Coil. Generator Stator. Lighting Coil. Rotor CDI HT-Coil. CC Model Engine/Code Year Stator Kit
Generator Stator Ignition Lighting Pick-Up Rotor CDI HT- 50 AR50 A1/C2-C10 1982-1992 50 KDX50 A1-A3/A6F 2003-2006 50 KMX50 (KS-I) A1/A2 1988-1989 50 KMX50 (KSR-I) B1-B6 1990-1998 80 AR80 A1/C2-C8 1982-1990
More informationCROSS REFERENCE - MIFAB vs WADE
CROSS REFERENCE - vs FLOOR DRAINS F-1000-C...1100-C-MR5 F-1100...1000 F-1100-C... 1000-C F-1100-C-DD... 1000-C-HD F-1100-DD...1000-HD F-1100-EF...1000-EF4 F-1100-C-EF...1000-C-EF4 F-1100-EG... 1000-EG8
More informationSITRANS F flowmeters. SITRANS F O delta p - Primary differential pressure devices. Orifice plate with annular chambers. 4/358 Siemens FI
Application Dimensional drawings Suitable for non-corrosive and corrosive gases, vapors and liquids; permissible operating temperature -60 to +550 C. Design Two support rings with replaceable orifice disk
More informationPRODUCT GUIDE LANDSCAPE LIGHTING
PRODUCT GUIDE LANDSCAPE LIGHTING North America fxl.com FINISHES Metals AB Antique Bronze on Powder coat Standard AB Antique Bronze on Brass AT Antique Tumbled on AT Antique Tumbled on Brass CU BS Natural
More informationNational Routing Number Administration p-ani Activity and Projected Exhaust Report
National Routing Number Administration 2016 p-ani Activity and Projected Exhaust Report The ATIS Industry Numbering Committee developed the P-ANI Administration Guidelines, which contain the following
More informationLEG EXTENSION OWNER'S MANUAL
TM LEG EXTENSION OWNER'S MANUAL REVISED: Sept. 2,1998 90 98 19 10 P 110 9 50,52A 150 SERIAL NO.'S through 109 1 2 5 6 8 Contents Parts Manual SEAT FRAME / CROSSMEMBER ASSEMBLY SEAT FRAME ASSEMBLY WORKBOX
More informationL,r+6phar : iifrr,(v)
Plese keep wriften mteril within the bx t mke phtcpying esier iffiti"j M Use BAGK ink nly Indicte whether "bkwrk" () l,m (prese number"".n.1sj E r m ft ^6c:r/-)-tl/+&-rV^)J }c)-w-, (t ttl 20 fr ech 2,r+6phr
More informationAmerican Round Fuses - Form 101 range
Form 0 A5QS - 50 Vac A5QS- D007J 0 A5QS- E007J 0 A5QS- F0074J 0 4 A5QS4- G0075J 0 5 A5QS5- H007J 0 A5QS- J0077J 0 7 A5QS7- K0078J 0 8 A5QS8- L0079J 0 0 A5QS0- N008J 0 A5QS- P008J 0 5 A5QS5- Q008J 0 0 A5QS0-
More informationRM/900/M Heavy duty cylinders Ø 1 1/4... 4
Heavy duty cylinders Ø 1 1/4... 4 Heavy duty cylinder ideal for a wide range of rail applications Extensive range of mountings Rugged, reliable long established design Magnetic piston as standard Mounting
More informationFigure S1. Helical regions predicted by JPred in p53 TAD
Figure S1 Helical regions predicted by JPred in p53 TAD OrigSeq Jnet jhmm jpssm : 1---------11--------21--------31--------41--------51-------- : : MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP
More informationOrder No. of the options EMC filter Class A
Ordering Data for Variant Dependent Options The options listed here (filters, chokes, brake resistors, gland plates, fuses and circuit breakers) are inverter specific. The inverter and the associated options
More informationISC CATALOG LEGEND Price update: November 2013
0012-0267 6 36 0012-7011 6 36 004T008 3 32 5.8 006T010 3 32 5.8 008T012 3 32 5.8 010-1401 7 27 153.94 010-1402 7 27 133.59 010-1483 7 27 133.59 010-1894 7 27 205.63 010-2054 7 27 153.99 010T014 3 32 6.1
More information, NAS!?r-s~~if.{" WOQi2AN PIGS: FINAt:. EST'IHATES (STATISTICAL,,,", BULLETIN.) NATIONAL ' AGRICULTURAL STATISTICS SERVICE,, ':-'-"'-'-,,
, NAS!?r-s~~if.{" WOQi2AN PIGS: FINAt:. EST'IHATES 1988-92. (STATISTICAL,,,", BULLETIN.) NATIONAL ' AGRICULTURAL STATISTICS SERVICE,, ':-'-"'-'-,, WASHINGTOH, DC. DEC 9 57P' ~ alii Association for Informat
More informationMulti-Stage Selective Catalytic Reduction of NO in Lean-Burn Engine Exhaust. B. M. Penetrante M. C. Hsiao B. T. Merritt G. E.
UCRL-JC-128071 PREPRINT Multi-Stage Selective Catalytic Reduction of in Lean-Burn Engine Exhaust x B. M. Penetrante M. C. Hsiao B. T. Merritt G. E. Vogtlin This paper was prepared for submittal to the
More informationCROSS REFERENCE LIST AIRTEX
AIRTEX E10007 7.21659.72 E10008 7.21659.72 E10009 7.21287.53 E10200M 72 200 00 E10201M 73 006 01 E10202M 73 010 00 E10202M ESS 273 E10203M 73 014 01 E10204M 73 068 00 E10205M 73 080 01 E10206M 73 080 02
More informationBore ø 32, 40, 50, 63, 80, 100, 125 Ports 32 = 1/8, 40/50 = 1/4, 63/80 = 3/8, 100/125 = 1/2
6 S E R I E S Cylinders Series 6 Catalog 2006 Single, double acting, magnetic (DIN/ISO 643) Bore: ø 32, 40, 50, 63, 80, 00, 25 cushioned [ /4, 9/6, 2, 2 /2, 3 /8, 4, 5 inch approximations] The Series 6
More informationPROTEX SHOCK ABSORBER CATALOGUE
Daihatsu S70V, S75V, S76V 82-96 Rear HD Gas S2000 Dodge AT4-114, 129 (1Ton), AT4-229, 329, 353, 560, 575 62-71 Rear HD Gas S2013 Ford PC 2.0, 2.2 2WD Ute 6/85-88 Front Gas S1005 PC, PD 2.0, 2.2, 2.5, 2.6
More information3VF3 to 3VF8 Circuit-Breakers
3VF3 to 3VF8 Circuit-Breakers Accessories Operating mechanisms For other s for 3VF3 with knob Rotary drive, complete, scope of supply Cubicle door for 3VF6 Motor operating mechanism for 3VF3 Motor operating
More informationCombined pump and gripper Medium
VGS 3010 H D W Dimension and connection W D H Feed pressure Vacuum Exhaust/blow mm mm mm 1 Housing VGS3010 23 30 Ø6 mm, 3x G1/8", M5 2 COAX cartridge 2:1 No COAX cartridge 65 2:2 COAX cartridge 2-stage
More informationRouteing Point or Interchange Maps
Aberdeen AA DA DS EC FD FK GA GS HA IE IP NS PA YA YS Accrington BK CK CP CU DH DP DW EP GP JK JP KH KM KN KW MH NN NP PP XP Aigburth BV CH CP CV EV GV HV JP KW ME ML NR NV PV RV VK VN VT XV Alexandra
More informationAvailable: Cylinders till july 2000 Spares till july /98 N
Available: Cylinders till july 2000 RM/55400/M Roundline Cylinders Magnetic Piston Double Acting 32 to 100 mm bore Magnet piston as standard provides a wide range of control options Attractive clean- line
More informationis INTERMTICf{AL ARFORT Location: 3411 SW 27th St., Ft. Lauderdale 33312
trr. FffiT t"t"fgrnrue"hotlwuoo Site:8 is INTERMTIf{L RFORT Loation: 34 SW 27th St., Ft. Lauderdale 3332 -r*@ Period: Feb 20 ," ' FORT LI'ERLE ijollywoffi sire: 8 '..Wi::.:T";::..:-ry27thStFt.Lauderda
More informationRM/28000/M Roundline cylinders (ISO)
RM/28000/M Roundline cylinders (ISO) Single acting, ISO 6432 - Ø 10... 25 mm Magnetic piston as standard enerally conforms to ISO 6432 High strength, double crimped end cap design Corrosion resistant Nose
More informationCree XLamp XB-D LEDs. binning & Labeling
binning & Labeling CLD-AP91 rev 6 Cree XLamp XB-D LEDs Table of Contents Introduction www. cree.com/xlamp Introduction... 1 Bin and Order-Code Format... 2 Performance Groups Luminous or Radiant Flux...
More informationSECTION A-A TPA AND ALIGNMENT PLATE IN PRE-SEATED POSITION
THIS RWING IS UNPULISHE. OPYRIGHT Y TE ONNETIVITY RELESE FOR PULITION LL RIGHTS RESERVE. P LTR ESRIPTION TE WN PV REVISE PER EO00 MR JMS H REVISE PER EO00 PR JMS H QTY. REQUIRE INEX INEX INEX LIST OF PRTS
More information>^" !er. VOLUME X`lII. mum ,A, 51 N
>^"-.-7...1!er VLME X`lII,A, 51 mum www.mericnrdihistry.cm I LEADER PAGE 17-1 LEADER ELECTRICS CRP. MDEL 77 ' V 4 V ' --- mm rlcej 1',r1 K(n V\` 93WI ó ce J_- j. Y Le, m Ñ n R M K C Y I -W îw _ I I _u-,
More informationPNEUMATIC VALVE MANIFOLDS 11 mm - Series 501 M7 or with push-in fittings Ø6 mm
PNEUMATIC VALVE MANIFOLDS mm - Series 50 M7 or with push-in fittings Ø6 mm Series G3 50 Types MULTIPOL-BUS new 50 D/3D CAD models - In 3D 0056GB-0/R0 6 Manifold assemblies kit (Electronic + End plate)
More informationMCC SMBJ5.0 THRU SMBJ440CA. Features. Transient Voltage Suppressor 5.0 to 440 Volts 600 Watt. Mechanical Data
omponents 20736 Marilla Street Chatsworth!"# $%!"# SMBJ5.0 THRU SMBJ440CA Features For surface mount applications in order to optimize board space Low profile package Fast response time: typical less than
More informationCERTIFICATE ANTIPOLLUTION OF WATER INSTALLATIONS
Mandated by AFNOR Certification CERTIFICATE ANTIPOLLUTION OF WATER INSTALLATIONS CSTB attests that the products referred to in the appendix comply with the characteristics described in the certification
More informationSeries 32 compact magnetic cylinders 1/ Single and double-acting, non-rotating ø 20, 25, 32, 40, 50, 63, 80, 100 mm
Series 32 compact magnetic cylinders Single and double-acting, non-rotating ø 20, 25, 32, 40, 50, 63, 80, 00 mm»» In compliance with ISO 2287»» Compact design»» Wide range of models available in different
More informationAluminium profile. TANDEM: Double thrust and traction forces. LOW FRICTION: Friction force reduced by over 40%
CATALOGUE > Release 8.7 > Series 6 cylinders Series 6 cylinders - Aluminium profile Single and double-acting, magnetic, cushioned Standard, low friction, low temperatures and tandem versions ø 32, 40,
More informationWAUBONSEE COMMUNITY COLLEGE Sugar Grove, Illinois Catalog
ACC 110 (AC 151) NT 111 (AC 152) NT 120 (AC 101) ATG 157 121 (AC 102) ATG 158 130 (AC 153) NT 201 (AC 260) NT 205 (AC 265) NT 220 (AC 251) NT 221 (AC 252) NT 230 (AC 167) NT 240 (AC 221) ATG 204 250 NT
More information2 Piece Soft Door Kit Installation Instructions
2 Piece Soft Door Kit Installation Instructions For: Toyota Land Cruiser FJ40 Part Number: 51774 1964-1984 (Soft Doors Only, Top Kit not included) DO NOT INSTALL THIS PRODUCT ON ANY VEHICLE OTHER THAN
More informationWestinghouse Electric Corporation large Motor Division Buffalo, New York, U.S.A
(I June, 7 large Motor Division Frames 83 to 1 Frames 83 to 11 Shunt. Frames 83 and 3 with Series Coil 370 FWEA Page 1 See Page 2 for Frames to 1 with Series Coil Standard right hand mounting shown. Position
More information250 psi rating. series. pneumatic cylinders. bulletin 0606ST.
20 psi rating series ST pneumatic cylinders bulletin 0606ST www.royalcylinders.com i Contents Page Description 1 Mounting Styles 2 Features Description Mounting dimensions 3 STNM No Mount (MX0) 3 STME
More information1980/89 ILLUSTRATION SECTION A70 C LIGHTTRUCK INDEX
1980/89 ILLUSTRATION SECTION A70 C INDEX YEAR 19_ TITLE * 06 TYPE TRANSMISSION - Cont d MODEL SECTION PAGE ILLUS. NO. EXTERNAL_PARTS - ConEd 60/ Steering column - 1980/81 - fixed wheel - 1982/ - fixed
More informationPRONE LEG CURL OWNER'S MANUAL
TM TM 97 105 19 1 1 73 PRONE LEG CURL OWNER'S MANUAL REVISED: May 15,1998 119 51 SERIAL NO.'S through Contents Parts Manual 1 3 4 5 6 7 8 SEAT FRAME ASSEMBLY WORKBOX & CROSSMEMBER ASSEMBLY MOVEMENT ARM
More information1.56 L INEAR A CTUATORS: AIR C YLINDERS S ERIES CA1
1.56 L INEAR A CTUATORS: AIR C YLINDERS A IR C YLINDER Auto switch sensing optional s Ø4, 5, 63, 8, 1 Non-rotating piston rod & double rod types available Ultra low friction, maximum 5% Long life, high
More information